Everything below concerns electron paramagnetic resonance. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2026-01-07. Numbers and descriptions here follow the published literature rather than marketing material.
GHK-Cu is a coordination complex formed between the peptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The unbound chain, abbreviated GHK, consists of three amino acids and occurs naturally in human plasma, saliva, and urine. Binding of the metal is mediated mainly by the imidazole nitrogen of the histidine residue together with backbone amides, producing a stable chelate. Ingredient nomenclature often lists the same substance as copper tripeptide-1. Its charge and solubility behaviour differ from those of the metal-free chain.
The copper-binding activity of this sequence was described in the 1970s during studies of liver tissue and plasma factors. Early work identified the peptide as a component that influenced copper uptake by cells and that appeared in wound fluid. Later investigations examined its presence across species, reporting the same chain in human and animal samples. A decline in measured concentration with age became a recurring observation, although the underlying causes remain incompletely characterised.
Published studies describe the complex in several research contexts, including collagen synthesis, antioxidant behaviour, and wound repair models. Much of this work is conducted in cultured cells or in small animal systems, and the findings are frequently cited in reviews of copper peptides. Direct clinical evidence in humans is comparatively limited, and reported outcomes vary with formulation and study design. Whether free chain or metal-bound form was used is not always stated, a point that complicates comparison between reports.
Copper takes part in redox chemistry, and the same property that makes it useful in enzymes can generate reactive oxygen species when the ion is loosely bound. GHK chelates copper through imidazole, amino, and amide nitrogen donors, which reduces the amount of free copper in solution. Whether that chelation is protective, neutral, or harmful in a given tissue is not settled. Laboratory assays report both antioxidant and pro-oxidant behavior, depending on the conditions and the readout used.
Published work on GHK-Cu is dominated by in vitro experiments and small animal studies. Human trials tend to be short and small, with endpoints such as skin appearance rather than clinical outcomes. Review articles often summarize the same underlying laboratory findings, which can make the evidence base look broader than it is. Several basic questions remain open: the concentration of the intact complex in human tissue, the route by which it crosses the skin barrier, and whether effects seen in culture produce measurable changes in people.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Copper(II) peptide complex | Coordination compound rather than a simple salt |
| Peptide sequence | Glycyl-L-histidyl-L-lysine | Abbreviated GHK in most literature |
| Molecular formula | C14H22N6O4Cu | Reported for the 1:1 complex |
| Principal binding site | Histidine imidazole nitrogen | Backbone amides contribute additional coordination |
| Common synonym | Copper tripeptide-1 | Used in ingredient and product labelling |
Solid GHK-Cu is generally stored as a dry powder under frozen conditions to limit degradation. The peptide bond can hydrolyze, and the copper center can be displaced by strong chelators such as EDTA. Aqueous solutions are less stable than the solid and may lose color or form precipitates over time. Temperature, pH, and oxygen exposure are the main variables that affect shelf life. Neutral to slightly acidic conditions tend to preserve the complex better than strongly alkaline media.
Routine handling calls for minimizing freeze-thaw cycles and preparing solutions shortly before use. Glass or inert plastic containers reduce adsorption and metal leaching. Working stocks are often kept at 2–8 °C for short periods, while long-term reference material stays at −20 °C or below. Light protection is prudent because prolonged exposure may accelerate oxidation of the peptide. Documentation of lot number, concentration, and preparation date supports reproducibility in laboratory work.
Analytical verification typically combines reversed-phase high-performance liquid chromatography with ultraviolet-visible detection. The copper complex absorbs visible light near 600–630 nm, giving a characteristic blue signal. Mass spectrometry confirms molecular mass and can detect free peptide or mismatched copper stoichiometry. Copper content is often measured independently by inductively coupled plasma mass spectrometry or atomic absorption spectroscopy. Purity, counterion identity, and residual solvents are additional quality-control parameters that methods may address.
Proposed mechanisms for copper peptide activity center on delivery of copper ions to cells and on peptide fragments acting as signaling molecules. Copper is a cofactor for enzymes involved in collagen cross-linking and antioxidant defense, and the peptide may improve its availability at target sites. Separately, the tripeptide and its breakdown products have been reported to influence gene expression in cultured fibroblasts. Much of this evidence comes from laboratory cell cultures and animal models rather than controlled human trials. The relative contribution of the copper ion and the peptide sequence is therefore not fully settled.
Stability depends on temperature, light exposure, moisture, and the presence of oxidizing or reducing agents. Solid material held dry and protected from light is generally more stable than aqueous solutions, which can undergo gradual degradation. Recommended storage in much of the literature is a freezer at around minus twenty degrees Celsius for long-term retention, with working aliquots kept cold and shielded from light. Repeated freeze-thaw cycles and alkaline pH are commonly noted as factors that accelerate loss of the intact complex, though exact degradation rates vary.
Analytical confirmation usually combines a separation method with a copper-specific measurement. Liquid chromatography or mass spectrometry establishes peptide identity and purity, while an elemental measurement quantifies the metal content. A frequent misconception is that any blue solution contains an intact copper peptide complex; color alone does not confirm structure, because free copper salts and degraded mixtures can also appear colored. Literature on efficacy is mixed, with in vitro findings often more dramatic than human evidence, and reviews note small sample sizes and short follow-up. Open questions include optimal concentration, skin penetration, and long-term effects.
Stability of the complex in solution depends on pH, temperature, and the presence of competing ligands. It is generally described as more resistant to breakdown than the metal-free chain, since coordination reduces susceptibility to enzymatic attack. Oxidation and hydrolysis can nevertheless proceed over time in aqueous media. Storage guidance in laboratory settings commonly involves refrigeration, protection from light, and avoidance of strongly alkaline conditions. Published data on long-term behaviour vary considerably and depend on the specific matrix.
Handling practices for the solid material emphasise low temperature and dryness. The lyophilised or powdered form is typically kept at refrigerator or freezer temperatures together with a desiccant. Working solutions are often prepared fresh, because repeated freeze-thaw cycles and extended storage may alter the complex. Glass or inert plastic containers are preferred over materials that could leach metal ions into the preparation. Such practices follow general peptide conventions rather than substance-specific regulations.
Bio-Synthesis, Inc. (BSI) is a biotechnology company headquartered in Lewisville, Texas. It is a provider of custom and catalog peptides, custom oligos, antibodies, organic synthesis, and analytical services. Biomedical researchers worldwide in universities, biotech companies, private clinics, and government agencies use products from Bio-Synthesis, Inc. in studies ranging from PCR diagnostics to cancer research and the Human Genome Project.
Antimicrobial peptides are produced by species across the tree of life, including: bacteria (e.g. bacteriocin, and many others) fungi (e.g. peptaibols, plectasin, and many others) cnidaria (e.g. hydramacin, aurelin) many from insects and arthropods (e.g. cecropin, attacin, melittin, mastoparan, drosomycin, thioester-containing protein 1) amphibia, frogs (magainin, dermaseptin, aurein, and others) birds (e.g. avian defensins) and mammals (e.g. cathelicidins, alpha- and beta-defensins, regIII peptides) Research has increased in recent years to develop artificially-engineered mimics of antimicrobial peptides such as SNAPPs, in part due to the prohibitive cost of producing naturally-derived AMPs. An example of this is the facially cationic peptide C18G, which was designed from the C-terminal domain of human platelet factor IV. Currently, the most widely used antimicrobial peptide is nisin; being the only FDA approved antimicrobial peptide, it is commonly used as an artificial preservative.
Automated synthesis or automatic synthesis is a set of techniques that use robotic equipment to perform chemical synthesis using a robotic system run using software control. Automating processes allows for higher efficiency and product quality although automation technology can be cost-prohibitive and there are concerns regarding overdependence and job displacement. Chemical processes were automated throughout the 19th and 20th centuries, with major developments happening in the previous thirty years, as technology advanced. Tasks that are performed may include: synthesis in variety of different conditions, sample preparation, purification, and extractions. Applications of automated synthesis are found on research and industrial scales in a wide variety of fields including polymers, personal care, and radiosynthesis.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Sources: en.wikipedia.org
An ion-exchange membrane is generally made of organic or inorganic polymer with charged (ionic) side groups, such as ion-exchange resins. Anion-exchange membranes contain fixed cationic groups with predominantly mobile anions; because anions are the majority species, most of the conductivity is due to anion transport. The reverse holds for cation-exchange membranes. The so-called heterogeneous ion-exchange membranes have low cost and a thicker composition with higher resistance and a rough surface that can be subject to fouling. Homogeneous membranes are more expensive, but have a thinner composition with lower resistance and a smooth surface, less susceptible to fouling. Homogeneous membrane surfaces can be modified to alter the membrane permselectivity to protons, monovalent ions, and divalent ions. The selectivity of an ion-exchange membrane is due to Gibbs-Donnan equilibrium and not due to physically blocking or electrostatically excluding specific charged species. The selectivity to the transport of ions of opposite charges is called its permselectivity.
Much of the genetic manipulation done in CHO cells is done in cells lacking DHFR enzyme. This genetic selection scheme remains one of the standard methods to establish transfected CHO cell lines for the production of recombinant therapeutic proteins. The process begins with the molecular cloning of the gene of interest and the DHFR gene into a single mammalian expression system. The plasmid DNA carrying the two genes is then transfected into cells, and the cells are grown under selective conditions in a thymidine-lacking medium. Surviving cells will have the exogenous DHFR gene along with the gene of interest integrated in its genome. The growth rate and the level of recombinant protein production of each cell line varies widely. To obtain a few stably transfected cell lines with the desired phenotypic characteristics, evaluating several hundred candidate cell lines may be necessary. The CHO and CHO-K1 cell lines can be obtained from a number of biological resource centres such as the European Collection of Cell Cultures, which is part of the Health Protection Agency Culture Collections. These organizations also maintain data, such as growth curves, timelapse videos of growth, images, and subculture routine information.
The study of bionics often emphasizes implementing a function found in nature rather than imitating biological structures. For example, in computer science, cybernetics models the feedback and control mechanisms that are inherent in intelligent behavior, while artificial intelligence models the intelligent function regardless of the particular way it can be achieved. The conscious copying of examples and mechanisms from natural organisms and ecologies is a form of applied case-based reasoning, treating nature itself as a database of solutions that already work. Proponents argue that the selective pressure placed on all natural life forms minimizes and removes failures. Although almost all engineering could be said to be a form of biomimicry, the modern origins of this field are usually attributed to Buckminster Fuller and its later codification as a house or field of study to Janine Benyus. There are generally three biological levels in the fauna or flora after which technology can be modeled:
Sources: en.wikipedia.org
GHK denotes the unbound chain of three amino acids. GHK-Cu describes the form in which a copper(II) ion is held by that chain. The two are not interchangeable in solution, since charge, molecular weight, and reactivity differ.
The chain occurs in human plasma, saliva, and urine. Measured amounts are reported to fall with age. Copper binding by the sequence is treated as part of normal metal handling in tissue.
The bound copper(II) centre contributes to redox behaviour and to stability under physiological conditions. Free copper ions can participate in reactions that generate reactive species, while chelated metal is generally more controlled. The chain may also serve as a carrier for copper in experimental systems.
It is not approved as a pharmaceutical in major markets and is used mainly as a cosmetic ingredient and a laboratory reagent. Regulatory status varies by country and by the product category in which it appears. Claims about therapeutic effects should be treated separately from permitted cosmetic labeling.